SDH/QFR Flavoprotein alignment


  jump to: vertical alignment  or  FASTA/PIR format
 
 0 10
| | | | | |
Homo MSGVRGLSRLLSARRL-ALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYP
                                                                        
130 140 150 0 10 180
| | | | | |
Rbcaps ----------------------------------------------------MASYTYET
Pcdeni ----------------------------------------------------MAAYKYET
Homoxx2 --------------------------------------------SAKVSDSISAQYPVVD
cattle
--------------------------------------------SAKVSDAISAQYPVVD
Gallus --------------------------------------------STKVSDSISTQYPVVD
Sccere --------------------------------------QTQGSVNGSASRSADGKYHIID
EcoliSDH -------------------------------------------------------MKLPV
EcoliFDR ---------------------------------------------------------MQT
Wolinel ---------------------------------------------------------MKV
shewanella EVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPH

20 30 40 50 60 70
| | | | | |
Rbcaps HNYDVVVVGAGGAGLRATLGMAEQ--GLRTACVTKVFPTRSHTVAAQGGIAASLGN-----
Pcdeni HEYDVVVVGAGGAGLRATLGMAEQ--GLRTACVTKVFPTRSHTVAAQGGIAASLSN-----
Homoxx2 HEFDAVVVGAGGAGLRAAFGLSEA--GFNTACVTKLFPTRSHTVAAQGGINAALGN-----
cattle HEFDAVVVGAGGAGLRAAFGLSEA--GFNTACVTKLFPTRSHTVAAQGGINAALGN-----
Gallus HEFDAVVVGAGGAGLRAAFGLSEA--GFNTACVTKLFPTRSHTVAAQGGINAALGN-----
Sccere HEYDCVVIGAGGAGLRAAFGLAEA--GYKTACISKLFPTRSHTVAAQGGINAALGN-----
EcoliSDH REFDAVVIGAGGAGMRAALQISQS--GQTCALLSKVFPTRSHTVSAQGGITVALGN-----
EcoliFDR FQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVA-------
Wolinel QYCDSLVIGGGLAGLRAAVATQQK--GLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMS-
shewanella DTVDVVVVGSGGAGFSAAISATDS--GAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAK

80 90 100 110 120 130
| | | | | |
Rbcaps MGPDSWQWHMFDTVKGSDWLGDTDAMEYLARSAPAAVYELEHYGVPFSRTEAGKIYQRPFG
Pcdeni MGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRPFG
Homoxx2 MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFG
cattle MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFG
Gallus MEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFG
Sccere MHKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGKIYQRAFG
EcoliSDH
THEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
EcoliFDR
QDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDG--------
Wolinel
-DGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINA
shewanella KITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVG-------MMG

140 150 160 170 180
| | | | | |
Rbcaps --------------GHTTEFGDGPPVQRTCAAADRTGHAILHTLYGQSLKN-NAEFFIEY
Pcdeni --------------GHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKE-KAEFFIEY
Homoxx2 --------------GQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRY-DTSYFVEY
cattle --------------GQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRY-DTSYFVEY
Gallus --------------GQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRY-DTSYFVEY
Sccere --------------GQTKEYGKGAQAYRTCAVADRTGHALLHTLYGQALRH-DTHFFIEY
EcoliSDH --------------GQSKNFG-GEQAARTAAAADRTGHALLHTLYQQNLKN-HTTIFSEW
EcoliFDR ----------SVNVRR---FG-GMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEH
Wolinel QKTTITEEDFRHGLIHSRDFG-GTKKWRTCYTADATGHTMLFAVANECLKL-GVSIQDRK
shewanella --------------------GASVNRAHRPTGGAGVGAHVVQVLYDNAVKR-NIDLRMNT

180 190 200 210 220
230 240
| | | |
| | |
Rbcaps FALDLIMSEDGVCQGVVCWKLDDGTFHVFNAKMTVLATGGYGR------------AYFSATSAHTCTGDGGG
Pcdeni FALDLIIT-DGACTGVVCWKLDDGTIHVFNAKMVVLATGGYGR
------------AYFSATSAHTCTGDGGG
Homoxx2 FALDLLME-NGECRGVIALCIEDGSIHRIRAKNTVVATGGYGR
------------TYFSCTSAHTSTGDGTA
cattle FALDLLME-SGECRGVIALCIEDGSIHRIRARNTVIATGGYGR
------------TYFSCTSAHTSTGDGTA
Gallus FALDLLME-NGECRGVIALCIEDGTIHRFRAKNTVIATGGYGR
------------TYFSCTSAHTSTGDGTA
Sccere FALDLLTH-NGEVVGVIAYNQEDGTIHRFRAHKTIIATGGYGR
------------AYFSCTSAHTCTGDGNA
EcoliSDH YALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGR
------------IYQSTTNAHINTGDGVG
EcoliFDR FVLDILVD-DGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGR
------------VYRYNTNGGIVTGDGMG
Wolinel EAIALIHQ-DGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGR------------IYKNTTNAVVCEGTGTA
shewanella RGIEVLKDDKGTVKGILVKGMYKG-YYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLD

240 250 260 270 280 290 300
| | | | | | |
Rbcaps MVARAGLA-LQDMEFVQFHPTGIYGSGCLITEGARGEGGYLTNSQGERFMERYAP-----
Pcdeni MVARAGLP-LQDMEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAP-----
Homoxx2 MITRAGLP-CQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAP-----
cattle MVTRAGLP-CQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAP-----
Gallus MVTRAGLP-CQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAP-----
Sccere MVSRAGFP-LQDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAP-----
EcoliSDH MAIRAGVP-VQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAP-----
EcoliFDR MALSHGVP-LRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETP
Wolinel IALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPE----
shewanella VAENAGGA-LKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEIT------

290 300 310 320 330 340 350 360
| | | | | |
Rbcaps ------HYKDLAPRDYVSRCMTLEIREGRGVG-EHKDHIHLNLSHLPKEALAERLPGISE
Pcdeni ------TYKDLASRDVVSRCITIEIREGRGVG-PHKDHMHLNLMHLPPESLAERLPGISE
Homoxx2 ------VAKDLASRDVVSRSMTLEIREGRGCG-PEKDHVYLQLHHLPPEQLATRLPGISE
cattle ------VAKDLASRDVVSRSMTLEIREGRGCG-PEKDHVYLQLHHLPPAQLAMRLPGISE
Gallus ------VAKDLASRDVVSRSMTIEIREGRGCG-PEKDHVYLQLHHLPPQQLATRLPGISE
Sccere ------TAKDLACRDVVSRAITMEIREGRGVG-KKKDHMYLQLSHLPPEVLKERLPGISE
EcoliSDH ------NAKDLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILE
EcoliFDR LGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICE
Wolinel -------KKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQE
shewanella ------------TRDKASAAILA----------QTGKSAYLIFDDSVRKSLSKIDKYIGL

350 370
| |
Rbcaps SAKIFAGVDV
----------------------------------
Pcdeni SAKIFAGVDV
----------------------------------
Homoxx2 TAMIFAGVDV
----------------------------------
cattle TAMIFAGVDV
----------------------------------
Gallus TAMIFAGVDV
----------------------------------
Sccere TAAIFAGVDV
----------------------------------
EcoliSDH LSRTFAHVDP
----------------------------------
EcoliFDR LAKAYVGVDP
----------------------------------
Wolinel ICEYFAGIDP----------------------------------
shewanella GVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFER

360 370 380 390 400
| | | | |
Rbcaps
----------TKEPIPVLPTVHYNMGGIPTNYWGEALN-PTADNPNAIVPGLMAVGEAGC
Pcdeni
----------TREPIPILPTVHYNMGGIPTNYWGEVLN-PTQDNPDQVFPGLMAVGEAGC
Homoxx2
----------TKEPIPVLPTVHYNMGGIPTNYKGQVLR--HVNGQDQIVPGLYACGEAAC
cattle
----------TKEPIPVLPTVHYNMGGIPTNYKGQVLR--HVNGQDQVVPGLYACGEAAC
Gallus
----------TKEPIPVLPTVHYNMGGIPTNYKGQVIT--HVNGEDKVVPGLYACGEAAS
Sccere
----------TKEPIPIIPTVHYNMGGIPTKWNGEALTIDEETGEDKVIPGLMACGEAAC
EcoliSDH
----------VKEPIPVIPTCHYMMGGIPTKVTGQALT-VNEKGEDVVVPGLFAVGEIAC
EcoliFDR
----------VKEPIPVRPTAHYTMGGIETDQNCET-----------RIKGLFAVGECSS
Wolinel ----------AEKWAPVLPMQHYSMGGIRTDYRGEA-----------KLKGLFSAGEAAC
shewanella PNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMN-----AKKQVIPGLYGAGEVTG

410 420 430 440 450 460
| | | | | |
Rbcaps ASVHGANRLGSNSLIDLVVFGRAAAIRAGEIVD--PKARPAAYNQASVDKCFARFDGLRH
Pcdeni ASVHGANRLGSNSLIDLVVFGRAAAIRAGQVID--REAQIPTTNKEQVDKALDRFDRIRN
Homoxx2 ASVHGANRLGANSLLDLVVFGRACALSIEESCR--PGDKVPPIKPNAGEESVMNLDKLRF
cattle ASVHGANRLGANSLLDLVVFGRACALSIAESCR--PGDKVPSIKPNAGEESVMNLDKLRF
Gallus ASVHGANRLGANSLLDLVVFGRACALTIAETCK--PGEPVPSIKPNAGEESVANLDKLRF
Sccere VSVHGANRLGANSLLDLVVFGRAVAHTVADTLQ--PGLPHKPLPSDLGKESIANLDKLRN
EcoliSDH VSVHGANRLGGNSLLDLVVFGRAAGLHLQESIA--EQGALRDASESDVEASLDRLNRWNN
EcoliFDR VGLHGANRLGSNSLAELVVFGRLAGEQATERAA-TAGNGNEAAIEAQAAGVEQRLKDLVN
Wolinel WDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVE
shewanella G-VHGANRLGGNAISDIITFGRLAGEEAAKYSKKN

460 470 480 490 500 510
| | | | | | |
Rbcaps AKGHTPTADLRLEMQRTMQADAAVFRTDKTLAEGKAKMTEIAAKVADLKVTDRSLIWNSD
Pcdeni ADGSVSTADLRLEMQRTMQADAAVFRTDKTLAEGVDKMRVIAGKLSDLKVTDRSLIWNSD
Homoxx2 ADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTD
cattle ANGSIRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKISSLYGDLRHLKTFDRGMVWNTD
Gallus ADGTIRTSEARLNMQKTMQSHAAVFRTGSILQEGCEKLSQIYRDLAHLKTFDRGIVWNTD
Sccere ANGSRSTAEIRMNMKQTMQKDVSVFRTQSSLDEGVRNITAVEKTFDDVKTTDRSMIWNSD
EcoliSDH NRNGEDPVAIRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQ
EcoliFDR QDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTD
Wolinel SKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKSVKELEELYKKSKNVGIKNKRLHANPE

520 530 540 550 560 570
| | | | | |
Rbcaps LMETLELTNLMPNALATIVGAEARKESRGAHASED--HATRDDVN---------------
Pcdeni LMETLELTNLMPNALATIVAAEARKESRGAHAHED--YPERDDAN---------------
Homoxx2 LVETLELQNLMLCALQTIYGAEARKESRGAHARED--YKVRIDEYDYSKPIQGQQKKPFE
cattle LVETLELQNLMLCALQTIYGAEARKESRGGPRRED--FKERVDEYDYSKPIQGQQKKPFE
Gallus LVETLELQNLMLCALQTIYGAEARKESRGAHARED--YKLRIDEFDYSKPLQGQQKRPFE
Sccere LVETLELQNLLTCASQTAVSAANRKESRGAHARED--YPNRDDE----------------
EcoliSDH RVECLELDNLMETAYATAVSANFRTESRGAHSRFD--FPDRDDEN---------------
EcoliFDR LLYTIELGHGLNVAECMAHSAMARKESRGAHQRLD--EGCTERDDV--------------
Wolinel LEEAYRVPMMLKVALCVAKGALDRTESRGAHNRED--YPKRDDINWLNRTLASWPNPEQT

580 590 600 610
| | | | |
Rbcaps ------------WRKHSIMRVED--N------KVDLSYRPVITEPLTTEAEGGISLAKIA
Pcdeni ------------WRKHSLAWIEG--N------DVKLAYRPVHLEPLTRQDEGGIDLKKIA
Homoxx2 E----------HWRKHTLSYVDVGTG------KVTLEYRPVIDKTLNEA-----DCATVP
cattle Q----------HWRKHTLSYVDIKTG------KVTLEYRPVIDRTLNET-----DCATVP
Gallus E----------HWRKHTLSYVDVKSG------KVTLKYRPVIDRTLNEE-----DCSSVP
Sccere -----------HWMKHTLSWQKDVAA------PVTLKYRRVIDHTLDEK-----ECPSVP
EcoliSDH ------------WLCHSLYLPES----------ESMTRRSVNMEPKLR--------
PAFP
EcoliFDR -----------NFLKHTLAFRDADG-------TTRLEYSDVKI
-------------TTLP
Wolinel LPTLEYEALDVNEMEIAPRYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQ

620 630
| | |
Rbcaps PKARTF------------------------
Pcdeni PKARVY------------------------
Homoxx2 PAIRSY------------------------
cattle PAIRSY------------------------
Gallus PAIRSY------------------------
Sccere PTVRAY------------------------
EcoliSDH PKIRTY------------------------
EcoliFDR PAKRVYGGEADAADKAEAANKKEKANG---
Wolinel EALMPYELPAKYKARNERLGDK--------






1 Homo
2 cattle
3 Gallus
4 Sccere
5 Rbcaps
6 Pcdeni
7 EcoliSDH
8 EcoliFRD
9 Wolinel
10 shewanella

key residues:
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
 222  H56   H56   H56   H62   H48   H48   H45   H44   H43   N164 FAD cov link
453 H253 H253 H253 H259 H246 H245 H242 H232 H257 H365<--Highly conserved HPT -
454 P254 P254 P254 P260 P247 P246 P243 P233 P258 P366 H is OAA ligand
455 T255 T255 T255 S261 T248 T247 T244 T234 T259 T367 break FAD/CAP domain
462 C262 C262 C262 C268 C255 C254 V251 I241 I266 V374 2nd choice NEM cys
465 T265 T265 T265 T271 T258 T257 T254 T244 T269 T377
466 E266 E266 E266 E272 E259 E258 E255 E245 E270 E378
467 G267 G267 G267 G273 G260 G259 G256 G246 G271 A379
468 C268 C268 C268 A274 A261 A260 C257 C247 C272 V380 <-- NEM-sensitivity
469 R269 R269 R269 R275 R262 R261 R258 R248 R273 R381 <-- Conserved R
470 G270 G270 G270 G276 G263 G262 G259 G249 G274 G382
471 E271 E271 E271 E277 E264 E263 E260 E250 D275 N383
472 G272 G272 G272 G278 G265 G264 G261 G251 G276 G384
508 R297 R297 R297 R303 R290 R289 R286 R287 R301 R402 <--R297
620 H364 H364 H364 H370 H357 H356 H354 H355 H369 H504 <--H364
666 R408 R408 R408 R416 R402 R401 R399 R390 R404 R544 <--H408 Ackrell's R450C mutation in humans?
Full table:
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
158 -- -- -- -- -- -- -- -- -- E102 FAD domain(part 1)

159 -- -- -- Q1 -- -- -- -- -- P103
160 -- -- -- T2 -- -- -- -- -- T104
161 -- -- -- Q3 -- -- -- -- -- I105
162 -- -- -- G4 -- -- -- -- -- A106
163 -- -- -- S5 -- -- -- -- -- E107
164 -- -- -- V6 -- -- -- -- -- L108
165 S1 S1 S1 N7 -- -- -- -- -- A109
166 A2 A2 T2 G8 -- -- -- -- -- K110
167 K3 K3 K3 S9 -- -- -- -- -- D111
168 V4 V4 V4 A10 -- -- -- -- -- K112
169 S5 S5 S5 S11 -- -- -- -- -- S113
170 D6 D6 D6 R12 -- -- -- -- -- E114
171 S7 A7 S7 S13 -- -- -- -- -- R115
172 I8 I8 I8 A14 -- -- -- -- -- Q116
173 S9 S9 S9 D15 M1 M1 -- -- -- A117
174 A10 A10 T10 G16 A2 A2 -- -- -- A118
175 Q11 Q11 Q11 K17 S3 A3 -- -- -- L119
176 Y12 Y12 Y12 Y18 Y4 Y4 M1 -- -- A120
177 P13 P13 P13 H19 T5 K5 K2 -- -- S121
178 V14 V14 V14 I20 Y6 Y6 L3 -- M1 A122
179 V15 V15 V15 I21 E7 E7 P4 Q1 K2 P123
180 D16 D16 D16 D22 T8 T8 V5 T2 V3 H124
181 H17 H17 H17 H23 H9 H9 R6 F3 Q4 D125
182 E18 E18 E18 E24 N10 E10 E7 Q4 Y5 T126
183 F19 F19 F19 Y25 Y11 Y11 F8 A5 C6 V127
184 D20 D20 D20 D26 D12 D12 D9 D6 D7 D128
185 A21 A21 A21 C27 V13 V13 A10 L7 S8 V129
186 V22 V22 V22 V28 V14 V14 V11 A8 L9 V130
187 V23 V23 V23 V29 V15 V15 V12 I9 V10 V131
188 V24 V24 V24 I30 V16 V16 I13 V10 I11 V132
189 G25 G25 G25 G31 G17 G17 G14 G11 G12 G133 G25,27,30 is Rossman turn motif
190 A26 A26 A26 A32 A18 A18 A15 A12 G13 S134
191 G27 G27 G27 G33 G19 G19 G16 G13 G14 G135
192 G28 G28 G28 G34 G20 G20 G17 G14 L15 G136
193 A29 A29 A29 A35 A21 A21 A18 A15 A16 A137
194 G30 G30 G30 G36 G22 G22 G19 G16 G17 G138
195 L31 L31 L31 L37 L23 L23 M20 L17 L18 F139
196 R32 R32 R32 R38 R24 R24 R21 R18 R19 S140
197 A33 A33 A33 A39 A25 A25 A22 A19 A20 A141
198 A34 A34 A34 A40 T26 T26 A23 A20 A21 A142
199 F35 F35 F35 F41 L27 L27 L24 I21 V22 I143
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
200 G36 G36 G36 G42 G28 G28 Q25 A22 A23 S144
201 L37 L37 L37 L43 M29 M29 I26 A23 T24 A145
202 S38 S38 S38 A44 A30 A30 S27 A24 Q25 T146
203 E39 E39 E39 E45 E31 E31 Q28 Q25 Q26 D147
204 A40 A40 A40 A46 Q32 Q32 S29 A26 K27 S148
205 -- -- -- -- -- -- -- N27 -- --
206 -- -- -- -- -- -- -- P28 -- --
207 G41 G41 G41 G47 G33 G33 G30 N29 G28 G149
208 F42 F42 F42 Y48 L34 L34 Q31 A30 L29 A150
209 N43 N43 N43 K49 R35 R35 T32 K31 S30 K151
210 T44 T44 T44 T50 T36 T36 C33 I32 T31 V152
211 A45 A45 A45 A51 A37 A37 A34 A33 I32 I153
212 C46 C46 C46 C52 C38 C38 L35 L34 V33 L154
213 V47 V47 V47 I53 V39 V39 L36 I35 L34 I155
214 T48 T48 T48 S54 T40 T40 S37 S36 S35 E156
215 K49 K49 K49 K55 K41 K41 K38 K37 L36 K157
216 L50 L50 L50 L56 V42 V42 V39 V38 I37 E158
217 F51 F51 F51 F57 F43 F43 F40 Y39 P38 P159
218 P52 P52 P52 P58 P44 P44 P41 P40 V39 V160
219 T53 T53 T53 T59 T45 T45 T42 M41 K40 I161
220 R54 R54 R54 R60 R46 R46 R43 R42 R41 G162
221 S55 S55 S55 S61 S47 S47 S44 S43 S42 G163
222 H56 H56 H56 H62 H48 H48 H45 H44 H43 N164 FAD cov link
223 T57 T57 T57 T63 T49 T49 T46 T45 S44 A165
224 V58 V58 V58 V64 V50 V50 V47 V46 A45 K166
225 A59 A59 A59 A65 A51 A51 S48 A47 A46 L167
226 A60 A60 A60 A66 A52 A52 A49 A48 A47 A168
227 Q61 Q61 Q61 Q67 Q53 Q53 Q50 E49 Q48 A169
228 G62 G62 G62 G68 G54 G54 G51 G50 G49 G170
229 G63 G63 G63 G69 G55 G55 G52 G51 G50 G171
230 I64 I64 I64 I70 I56 I56 I53 S52 M51 M172
231 N65 N65 N65 N71 A57 A57 T54 A53 Q52 N173
232 A66 A66 A66 A72 A58 A58 V55 A54 A53 A174
233 A67 A67 A67 A73 S59 S59 A56 V55 S54 A175
234 L68 L68 L68 L74 L60 L60 L57 A56 L55 W176
235 G69 G69 G69 G75 G61 S61 G58 -- G56 T177
236 N70 N70 N70 N76 N62 N62 N59 -- N57 D178
237 -- -- -- -- -- -- -- -- S58 Q179
238 -- -- -- -- -- -- -- -- K59 Q180
239 -- -- -- -- -- -- -- -- M60 K181
240 -- -- -- -- -- -- -- -- S61 A182
241 -- -- -- -- -- -- -- -- -- K183
242 M71 M71 M71 M77 M63 M63 T60 Q57 -- K184
243 E72 E72 E72 H78 G64 G64 H61 D58 D62 I185
244 E73 E73 D73 K79 P65 P65 E62 H59 G63 T186
245 D74 D74 D74 D80 D66 D66 D63 D60 D64 D187
246 N75 N75 N75 N81 S67 N67 N64 S61 N65 S188
247 W76 W76 W76 W82 W68 W68 W65 F62 E66 P189
248 R77 R77 R77 K83 Q69 Q69 E66 E63 D67 E190
249 W78 W78 W78 W84 W70 W70 W67 Y64 L68 L191
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
250 H79 H79 H79 H85 H71 H71 H68 H65 H69 M192
251 F80 F80 F80 M86 M72 M72 M69 F66 F70 F193
252 Y81 Y81 Y81 Y87 F73 Y73 Y70 H67 M71 E194
253 D82 D82 D82 D88 D74 D74 D71 D68 D72 D195
254 T83 T83 T83 T89 T75 T75 T72 T69 T73 T196
255 V84 V84 V84 V90 V76 V76 V73 V70 V74 M197
256 K85 K85 K85 K91 K77 K77 K74 A71 K75 K198
257 G86 G86 G86 G92 G78 G78 G75 G72 G76 G199
258 S87 S87 S87 S93 S79 S79 S76 G73 S77 G200
259 D88 D88 D88 D94 D80 D80 D77 D74 D78 Q201
260 W89 W89 W89 W95 W81 W81 Y78 W75 W79 N202
261 L90 L90 L90 L96 L82 L82 I79 L76 G80 I203
262 G91 G91 G91 G97 G83 G83 G80 C77 C81 N204
263 D92 D92 D92 D98 D84 D84 D81 E78 D82 D205
264 Q93 Q93 Q93 Q99 T85 T85 Q82 Q79 Q83 P206
265 D94 D94 D94 D100 D86 D86 D83 D80 K84 A207
266 A95 A95 A95 S101 A87 A87 A84 V81 V85 L208
267 I96 I96 I96 I102 M88 M88 I85 V82 A86 V209
268 H97 H97 H97 H103 E89 E89 E86 D83 R87 K210
269 Y98 Y98 Y98 Y104 Y90 Y90 Y87 Y84 M88 V211
270 M99 M99 M99 M105 L91 L91 M88 F85 F89 L212
271 T100 T100 T100 T106 A92 A92 C89 V86 V90 S213
272 E101 E101 E101 R107 R93 R93 K90 H87 N91 S214
273 Q102 Q102 Q102 E108 S94 E94 T91 H88 T92 H215
274 A103 A103 A103 A109 A95 A95 G92 C89 A93 S216
275 P104 P104 P104 P110 P96 P96 P93 P90 P94 K217
276 A105 A105 A105 K111 A97 K97 E94 T91 K95 D218
277 A106 S106 A106 S112 A98 A98 A95 E92 A96 S219
278 V107 V107 V107 I113 V99 V99 I96 M93 I97 V220
279 V108 V108 I108 I114 Y100 Y100 L97 T94 R98 D221
280 E109 E109 E109 E115 E101 E101 E98 Q95 E99 W222
281 L110 L110 L110 L116 L102 L102 L99 L96 L100 M223
282 E111 E111 E111 E117 E103 E103 E100 E97 A101 T224
283 N112 N112 N112 H118 H104 H104 H101 L98 A102 A225
284 Y113 Y113 Y113 Y119 Y105 Y105 M102 W99 W103 M226
285 G114 G114 G114 G120 G106 G106 G103 G100 G104 G227
286 M115 M115 M115 V121 V107 V107 L104 C101 V105 A228
287 P116 P116 P116 P122 P108 P108 P105 P102 P106 D229
288 F117 F117 F117 F123 F109 F109 F106 W103 W107 L230
289 S118 S118 S118 S124 S110 S110 S107 S104 T108 T231
290 R119 R119 R119 R125 R111 R111 R108 R105 R109 D232
291 T120 T120 T120 T126 T112 T112 L109 R106 I110 V233
292 E121 E121 E121 E127 E113 E113 D110 P107 H111 G234
293 D122 D122 E122 N128 A114 E114 D111 D108 K112 --
294 G123 G123 G123 G129 G115 G115 G112 G109 G113 --
295 K124 K124 K124 K130 K116 K116 R113 -- D114 --
296 I125 I125 I125 I131 I117 I117 I114 -- R115 --
297 Y126 Y126 Y126 Y132 Y118 Y118 Y115 -- M116 --
298 Q127 Q127 Q127 Q133 Q119 Q119 Q116 -- A117 --
299 R128 R128 R128 R134 R120 R120 R117 -- I118 --
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
300 A129 A129 A129 A135 P121 P121 P118 -- I119 M235
301 F130 F130 F130 F136 F122 F122 F119 -- N120 M236
302 G131 G131 G131 G137 G123 G123 G120 -- A121 G237
303 -- -- -- -- -- -- -- -- Q122 --
304 -- -- -- -- -- -- -- -- K123 --
305 -- -- -- -- -- -- -- -- T124 --
306 -- -- -- -- -- -- -- -- T125 --
307 -- -- -- -- -- -- -- -- I126 --
308 -- -- -- -- -- -- -- -- T127 --
309 -- -- -- -- -- -- -- -- E128 --
310 -- -- -- -- -- -- -- -- E129 --
311 -- -- -- -- -- -- -- -- D130 --
312 -- -- -- -- -- -- -- -- F131 --
313 -- -- -- -- -- -- -- S110 R132 --
314 -- -- -- -- -- -- -- V111 H133 --
315 -- -- -- -- -- -- -- N112 G134 --
316 -- -- -- -- -- -- -- V113 L135 --
317 G132 G132 G132 G138 G124 G124 G121 R114 I136 --
318 Q133 Q133 Q133 Q139 H125 H125 Q122 R115 H137 --
319 S134 S134 S134 T140 T126 T126 S123 -- S138 --
320 L135 L135 L135 K141 T127 T127 K124 -- R139 --
321 K136 K136 Q136 E142 E128 E128 N125 -- D140 --
322 F137 F137 F137 Y143 F129 F129 F126 F116 F141 --
323 G138 G138 G138 G144 G130 G130 G127 G117 G142 G238 Conserved Gly

324 K139 K139 K139 K145 D131 E131 -- -- -- A239
325 G140 G140 G140 G146 G132 G132 G128 G118 G143 S240 Conserved Gly

326 G141 G141 G141 A147 P133 P133 E129 M119 T144 V241
327 Q142 Q142 Q142 Q148 P134 P134 Q130 K120 K145 N242
328 A143 A143 A143 A149 V135 V135 A131 I121 K146 R243
329 H144 H144 H144 Y150 Q136 Q136 A132 E122 W147 A244
330 R145 R145 R145 R151 R137 R137 R133 R123 R148 H245
331 C146 C146 C146 T152 T138 T138 T134 T124 T149 R246
332 C147 C147 C147 C153 C139 C139 A135 W125 C150 P247 "active site" cysteine?
333 C148 C148 C148 A154 A140 A140 A136 F126 Y151 T248
334 V149 V149 V149 V155 A141 A141 A137 A127 T152 G249
335 A150 A150 A150 A156 A142 A142 A138 A128 A153 G250
336 D151 D151 D151 D157 D143 D143 D139 D129 D154 A251
337 R152 R152 R152 R158 R144 R144 R140 K130 A155 G252
338 T153 T153 T153 T159 T145 T145 T141 T131 T156 V253
339 G154 G154 G154 G160 G146 G146 G142 G132 G157 G254
340 H155 H155 H155 H161 H147 H147 H143 F133 H158 A255
341 S156 S156 S156 A162 A148 A148 A144 H134 T159 H256
342 L157 L157 L157 L163 I149 I149 L145 M135 M160 V257
343 L158 L158 L158 L164 L150 L150 L146 L136 L161 V258
344 H159 H159 H159 H165 H151 H151 H147 H137 F162 Q259
345 T160 T160 T160 T166 T152 T152 T148 T138 A163 V260
346 L161 L161 L161 L167 L153 L153 L149 L139 V164 L261
347 Y162 Y162 Y162 Y168 Y154 Y154 Y150 F140 A165 Y262
348 G163 G163 G163 G169 G155 G155 Q151 Q141 N166 D263
349 R164 R164 R164 Q170 Q156 Q156 Q152 T142 E167 N264
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
350 S165 S165 S165 A171 S157 S157 N153 S143 C168 A265
351 L166 L166 L166 L172 L158 L158 L154 L144 L169 V266
352 R167 R167 R167 R173 K159 K159 K155 Q145 K170 K267
353 Y168 Y168 Y168 H174 N160 E160 N156 F146 L171 R268
354 -- -- -- -- -- -- -- P147 -- --
355 D169 D169 D169 D175 N161 K161 H157 Q148 G172 N269
356 T170 T170 T170 T176 A162 A162 T158 I149 V173 I270
357 S171 S171 S171 H177 E163 E163 T159 Q150 S174 D271
358 Y172 Y172 Y172 F178 F164 F164 I160 R151 I175 L272
359 F173 F173 F173 F179 F165 F165 F161 F152 Q176 R273
360 V174 V174 V174 I180 I166 I166 S162 D153 D177 M274
361 E175 E175 E175 E181 E167 E167 E163 E154 R178 N275
362 Y176 Y176 Y176 Y182 Y168 Y168 W164 H155 K179 T276
363 F177 F177 F177 F183 F169 F169 Y165 F156 E180 R277
364 A178 A178 A178 A184 A170 A170 A166 V157 A181 G278
365 L179 L179 L179 L185 L171 L171 L167 L158 I182 I279
366 D180 D180 D180 D186 D172 D172 D168 D159 A183 E280
367 L181 L181 L181 L187 L173 L173 L169 I160 L184 V281
368 L182 L182 L182 L188 I174 I174 V170 L161 I185 L282
369 M183 M183 M183 T189 M175 I175 K171 V162 H186 K283
370 E184 E184 E184 H190 S176 T176 N172 D163 Q187 D284
371 -- -- -- -- E177 -- Q173 -- -- D285
372 N185 S185 N185 N191 D178 D177 D174 D164 D188 K286
373 G186 G186 G186 G192 G179 G178 G175 G165 G189 G287
374 E187 E187 E187 E193 V180 A179 A176 H166 K190 T288
375 C188 C188 C188 V194 C181 C180 V177 V167 C191 V289
376 R189 R189 R189 V195 Q182 T181 V178 R168 Y192 K290
377 G190 G190 G190 G196 G183 G182 G179 G169 G193 G291
378 V191 V191 V191 V197 V184 V183 C180 L170 A194 I292
379 I192 I192 I192 I198 V185 V184 T181 V171 V195 L293
380 A193 A193 A193 A199 C186 C185 A182 A172 V196 V294
381 L194 L194 L194 Y200 W187 W186 L183 M173 R197 K295
382 C195 C195 C195 N201 K188 K187 C184 N174 D198 G296
383 I196 I196 I196 Q202 L189 L188 I185 M175 L199 M297
384 E197 E197 E197 E203 D190 D189 E186 M176 V200 Y298
385 D198 D198 D198 D204 D191 D190 T187 E177 T201 K299
386 G199 G199 G199 G205 G192 G191 G188 G178 G202 G300
387 S200 S200 T200 T206 T193 T192 E189 T179 D203 --
388 I201 I201 I201 I207 F194 I193 V190 L180 I204 Y301
389 H202 H202 H202 H208 H195 H194 V191 V181 I205 Y302
390 R203 R203 R203 R209 V196 V195 Y192 Q182 A206 W303
391 I204 I204 F204 F210 F197 F196 F193 I183 Y207 V304
392 R205 R205 R205 R211 N198 N197 K194 R184 V208 K305
393 A206 A206 A206 A212 A199 A198 A195 A185 A209 A306
394 K207 R207 K207 H213 K200 K199 R196 N186 K210 D307
395 N208 N208 N208 K214 M201 M200 A197 A187 G211 A308
396 T209 T209 T209 T215 T202 V201 T198 V188 T212 V309
397 V210 V210 V210 I216 V203 V202 V199 V189 L213 I310
398 V211 I211 I211 I217 L204 L203 L200 M190 I214 L311
399 A212 A212 A212 A218 A205 A204 A201 A191 A215 A312
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
400 T213 T213 T213 T219 T206 T205 T202 T192 T216 T313
401 G214 G214 G214 G220 G207 G206 G203 G193 G217 G314
402 G215 G215 G215 G221 G208 G207 G204 G194 G218 G315
403 Y216 Y216 Y216 Y222 Y209 Y208 A205 A195 Y219 F316
404 G217 G217 G217 G223 G210 G209 G206 G196 G220 A317
405 R218 R218 R218 R224 R211 R210 R207 R197 R221 K318
406 -- -- -- -- -- -- -- -- -- N319
407 -- -- -- -- -- -- -- -- -- N320
408 -- -- -- -- -- -- -- -- -- E321
409 -- -- -- -- -- -- -- -- -- R322
410 -- -- -- -- -- -- -- -- -- V323
411 -- -- -- -- -- -- -- -- -- A324
412 -- -- -- -- -- -- -- -- -- K325
413 -- -- -- -- -- -- -- -- -- L326
414 -- -- -- -- -- -- -- -- -- D327
415 -- -- -- -- -- -- -- -- -- P328
416 -- -- -- -- -- -- -- -- -- S329
417 -- -- -- -- -- -- -- -- -- L330
418 T219 T219 T219 A225 A212 A211 I208 V198 I222 K331
419 Y220 Y220 Y220 Y226 Y213 Y212 Y209 Y199 Y223 G332
420 F221 F221 F221 F227 F214 F213 Q210 R200 K224 F333
421 S222 S222 S222 S228 S215 S214 S211 Y201 N225 I334
422 C223 C223 C223 C229 A216 A215 T212 N202 T226 S335
423 T224 T224 T224 T230 T217 T216 T213 T203 T227 T336
424 S225 S225 S225 S231 S218 S217 N214 N204 N228 N337
425 A226 A226 A226 A232 A219 A218 A215 G205 A229 Q338
426 H227 H227 H227 H233 H220 H219 H216 G206 V230 P339
427 T228 T228 T228 T234 T221 T220 I217 I207 V231 G340
428 S229 S229 S229 C235 C222 C221 N218 V208 C232 A341
429 T230 T230 T230 T236 T223 T222 T219 T209 E233 V342
430 G231 G231 G231 G237 G224 G223 G220 G210 G234 G343
431 D232 D232 D232 D238 D225 D224 D221 D211 T235 D344
432 G233 G233 G233 G239 G226 G225 G222 G212 G236 G345
433 T234 T234 T234 N240 G227 G226 V223 M213 T237 L346
434 A235 A235 A235 A241 G228 G227 G224 G214 A238 D347
435 M236 M236 M236 M242 M229 M228 M225 M215 I239 V348
436 I237 V237 V237 V243 V230 V229 A226 A216 A240 A349
437 T238 T238 T238 S244 A231 A230 I227 L217 L241 E350
438 R239 R239 R239 R245 R232 R231 R228 S218 E242 N351
439 A240 A240 A240 A246 A233 A232 A229 H219 T243 A352
440 G241 G241 G241 G247 G234 G233 G230 G220 G244 G353
441 L242 L242 L242 F248 L235 L234 V231 V221 I245 G354
442 P243 P243 P243 P249 A236 P235 P232 P222 A246 A355
443 -- -- -- -- -- -- -- -- Q247 --
444 C244 C244 C244 L250 L237 L236 V233 L223 L248 L356
445 Q245 Q245 Q245 Q251 Q238 Q237 Q234 R224 G249 K357
446 D246 D246 D246 D252 D239 D238 D235 D225 N250 D358
447 L247 L247 L247 L253 M240 M239 M236 M226 M251 M359
448 E248 E248 E248 E254 E241 E240 E237 E227 E252 Q360
449 F249 F249 F249 F255 F242 F241 M238 F228 A253 Y361
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
450 V250 V250 V250 V256 V243 V242 W239 V229 V254 I362
451 Q251 Q251 Q251 Q257 Q244 Q243 Q240 Q230 Q255 Q363
452 F252 F252 F252 F258 F245 F244 F241 Y231 F256 A364
|453 H253 H253 H253 H259 H246 H245 H242 H232 H257 H365 <-- Highly conserved HPT -
|454 P254 P254 P254 P260 P247 P246 P243 P233 P258 P366 H is OAA ligand
|455 T255 T255 T255 S261 T248 T247 T244 T234 T259 T367 FAD domain. <--"Hinge T"
|456 G256 G256 G256 G262 G249 G248 G245 G235 P260 L368 CAP domain
|457 I257 I257 I257 I263 I250 I249 I246 L236 L261 S369
|458 Y258 Y258 Y258 Y264 Y251 Y250 A247 P237 F262 V370
|459 G259 G259 G259 G265 G252 G251 G248 G238 P263 K371
|460 A260 A260 A260 S266 S253 S252 A249 S239 S264 G372
|461 G261 G261 G261 G267 G254 G253 G250 G240 G265 G373
|462 C262 C262 C262 C268 C255 C254 V251 I241 I266 V374
2nd choice cys
|463 L263 L263 L263 L269 L256 L255 L252 L242 L267 M375
|464 I264 I264 I264 I270 I257 I256 V253 M243 L268 V376
|465 T265 T265 T265 T271 T258 T257 T254 T244 T269 T377 <-- "Act-T"
466 E266 E266 E266 E272 E259 E258 E255 E245 E270 E378
467 G267 G267 G267 G273 G260 G259 G256 G246 G271 A379
468 C268 C268 C268 A274 A261 A260 C257 C247 C272 V380 <-- NEM-sensitivity
469 R269 R269 R269 R275 R262 R261 R258 R248 R273 R381 <-- Conserved R
470 G270 G270 G270 G276 G263 G262 G259 G249 G274 G382
471 E271 E271 E271 E277 E264 E263 E260 E250 D275 N383
472 G272 G272 G272 G278 G265 G264 G261 G251 G276 G384
473 G273 G273 G273 G279 G266 G265 G262 G252 G277 A385
474 I274 I274 I274 F280 Y267 Y266 Y263 I253 I278 I386
475 L275 L275 L275 L281 L268 L267 L264 L254 L279 L387
476 I276 I276 I276 V282 T269 T268 L265 V255 R280 V388
477 N277 N277 N277 N283 N270 N269 N266 N256 D281 N389
478 S278 S278 S278 S284 S271 S270 K267 K257 V282 R390
479 Q279 Q279 Q279 E285 Q272 E271 H268 N258 D283 E391
480 G280 G280 G280 G286 G273 G272 G269 G259 G284 G392
481 E281 E281 E281 E287 E274 E273 E270 Y260 H285 K393
482 R282 R282 R282 R288 R275 R274 R271 R261 R286 R394
483 F283 F283 F283 F289 F276 F275 F272 Y262 F287 F395
484 M284 M284 M284 M290 M277 M276 M273 L263 M288 V396
485 E285 E285 E285 E291 E278 E277 E274 Q264 P289 N397
486 R286 R286 R286 R292 R279 R278 R275 D265 D290 E398
487 Y287 Y287 Y287 Y293 Y280 Y279 Y276 Y266 Y291 I399
488 A288 A288 A288 A294 A281 A280 A277 G267 E292 T400
489 P289 P289 P289 P295 P282 P281 P278 M268 P293 --
490 -- -- -- -- -- -- -- G269 E294 --
491 -- -- -- -- -- -- -- P270 -- --
492 -- -- -- -- -- -- -- E271 -- --
493 -- -- -- -- -- -- -- T272 -- --
494 -- -- -- -- -- -- -- P273 -- --
495 -- -- -- -- -- -- -- L274 -- --
496 -- -- -- -- -- -- -- G275 -- --
497 -- -- -- -- -- -- -- E276 -- --
498 -- -- -- -- -- -- -- P277 -- --
499 -- -- -- -- -- -- -- K278 -- --
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
500 -- -- -- -- -- -- -- N279 -- --
501 V290 V290 V290 T296 H283 T282 N279 K280 -- --
502 A291 A291 A291 A297 Y284 Y283 A280 Y281 K295 --
503 K292 K292 K292 K298 K285 K284 K281 M282 K296 --
504 D293 D293 D293 D299 D286 D285 D282 E283 E297 --
505 L294 L294 L294 L300 L287 L286 L283 L284 L298 --
506 A295 A295 A295 A301 A288 A287 A284 G285 A299 --
507 S296 S296 S296 C302 P289 S288 G285 P286 S300 T401
508 R297 R297 R297 R303 R290 R289 R286 R287 R301 R402
  <--R297
509 D298 D298 D298 D304 D291 D290 D287 D288 D302 D403
510 V299 V299 V299 V305 Y292 V291 V288 K289 V303 K404
511 V300 V300 V300 V306 V293 V292 V289 V290 V304 A405
512 S301 S301 S301 S307 S294 S293 A290 S291 S305 S406
513 R302 R302 R302 R308 R295 R294 R291 Q292 R306 A407
514 S303 S303 S303 A309 C296 C295 S292 A293 R307 A408
515 M304 M304 M304 I310 M297 I296 I293 F294 M308 I409
516 T305 T305 T305 T311 T298 T297 M294 W295 I309 L410
517 L306 L306 I306 M312 L299 I298 I295 H296 E310 A411
518 E307 E307 E307 E313 E300 E299 E296 E297 H311 --
519 I308 I308 I308 I314 I301 I300 I297 W298 I312 --
520 R309 R309 R309 R315 R302 R301 R298 R299 R313 --
521 E310 E310 E310 E316 E303 E302 E299 K300 K314 --
522 G311 G311 G311 G317 G304 G303 G300 G301 G315 --
523 R312 R312 R312 R318 R305 R304 R301 N302 K316 --
524 G313 G313 G313 G319 G306 G305 G302 T303 G317 --
525 C314 C314 C314 V320 V307 V306 C303 I304 V318 --
526 G315 G315 G315 G321 G308 G307 D304 S305 Q319 --
527 -- -- -- -- -- -- G305 T306 S320 --
528 P316 P316 P316 K322 E309 P308 P306 P307 P321 Q412
529 E317 E317 E317 K323 H310 H309 W307 R308 Y322 T413
530 K318 K318 K318 K324 K311 K310 G308 G309 G323 G414
531 D319 D319 D319 D325 D312 D311 P309 D310 Q324 K415
532 H320 H320 H320 H326 H313 H312 H310 V311 H325 S416
533 V321 V321 V321 M327 I314 M313 A311 V312 L326 A417
534 Y322 Y322 Y322 Y328 H315 H314 K312 Y313 W327 Y418
535 L323 L323 L323 L329 L316 L315 L313 L314 L328 L419
536 Q324 Q324 Q324 Q330 N317 N316 K314 D315 D329 I420
537 L325 L325 L325 L331 L318 L317 L315 L316 I330 F421
538 H326 H326 H326 S332 S319 M318 D316 R317 S331 D422
539 H327 H327 H327 H333 H320 H319 H317 H318 I332 D423
540 L328 L328 L328 L334 L321 L320 L318 L319 L333 S424
541 P329 P329 P329 P335 P322 P321 G319 G320 G334 V425
542 P330 P330 P330 P336 K323 P322 K320 E321 R335 R426
543 E331 A331 Q331 E337 E324 E323 E321 K322 K336 K427
544 Q332 Q332 Q332 V338 A325 S324 V322 K323 H337 S428
545 L333 L333 L333 L339 L326 L325 L323 L324 I338 L429
546 A334 A334 A334 K340 A327 A326 E324 H325 E339 S430
547 T335 M335 T335 E341 E328 E327 S325 E326 T340 K431
548 R336 R336 R336 R342 R329 R328 R326 R327 N341 I432
549 L337 L337 L337 L343 L330 L329 L327 L328 L342 D433
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
550 P338 P338 P338 P344 P331 P330 P328 P329 R343 K434
551 G339 G339 G339 G345 G332 G331 G329 F330 D344 Y435
552 I340 I340 I340 I346 I333 I332 I330 I331 V345 I436
553 S341 S341 S341 S347 S334 S333 L331 C332 Q346 G437
554 E342 E342 E342 E348 E335 E334 E332 E333 E347 L438
555 T343 T343 T343 T349 S336 S335 L333 L334 I348 G439
556 A344 A344 A344 A350 A337 A336 S334 A335 C349 V440
557 M345 M345 M345 A351 K338 K337 R335 K336 E350 A441
558 I346 I346 I346 I352 I339 I338 T336 A337 Y351 P442
559 F347 F347 F347 F353 F340 F339 F337 Y338 F352 T443
560 A348 A348 A348 A354 A341 A340 A338 V339 A353 A444
561 G349 G349 G349 G355 G342 G341 H339 G340 G354 D445
562 V350 V350 V350 V356 V343 V342 V340 V341 I355 S446
563 D351 D351 D351 D357 D344 D343 D341 D342 D356 L447
564 V352 V352 V352 V358 V345 V344 P342 P343 P357 V448
565 -- -- -- -- -- -- -- -- -- K449
566 -- -- -- -- -- -- -- -- -- L450
CAP domain
(Shewanella big insert omitted)
608 -- -- -- -- -- -- -- -- -- G492
FAD domain
609 T353 T353 T353 T359 T346 T345 V343 V344 A358 N493
610 K354 K354 K354 K360 K347 R346 K344 K345 E359 Y494
611 E355 E355 E355 E361 E348 E347 E345 E346 K360 Y495
612 P356 P356 P356 P362 P349 P348 P346 P347 W361 A496
613 I357 I357 I357 I363 I350 I349 I347 I348 A362 I497
614 P358 P358 P358 P364 P351 P350 P348 P349 P363 E498
615 V359 V359 V359 I365 V352 I351 V349 V350 V364 V499
616 L360 L360 L360 I366 L353 L352 I350 R351 L365 T500
617 P361 P361 P361 P367 P354 P353 P351 P352 P366 P501
618 T362 T362 T362 T368 T355 T354 T352 T353 M367 G502
619 V363 V363 V363 V369 V356 V355 C353 A354 Q368 V503
620 H364 H364 H364 H370 H357 H356 H354 H355 H369 H504
  <--H364
621 Y365 Y365 Y365 Y371 Y358 Y357 Y355 Y356 Y370 H505
622 N366 N366 N366 N372 N359 N358 M356 T357 S371 T506
623 M367 M367 M367 M373 M360 M359 M357 M358 M372 M507
624 G368 G368 G368 G374 G361 G360 G358 G359 G373 G508
625 G369 G369 G369 G375 G362 G361 G359 G360 G374 G509
626 I370 I370 I370 I376 I363 I362 I360 I361 I375 V510
627 P371 P371 P371 P377 P364 P363 P361 E362 R376 M511
628 T372 T372 T372 T378 T365 T364 T362 T363 T377 I512
629 N373 N373 N373 K379 N366 N365 K363 D364 D378 D513
630 Y374 Y374 Y374 W380 Y367 Y366 V364 Q365 Y379 T514
631 K375 K375 K375 N381 W368 W367 T365 N366 R380 K515
632 G376 G376 G376 G382 G369 G368 G366 C367 G381 A516
633 Q377 Q377 Q377 E383 E370 E369 Q367 E368 E382 E517
634 V378 V378 V378 A384 A371 V370 A368 T369 A383 V518
635 L379 L379 I379 L385 L372 L371 L369 -- -- M519
636 R380 R380 T380 T386 N373 N372 T370 -- -- N520
637 -- -- -- I387 -- -- -- -- -- --
638 -- -- -- D388 P374 P373 V371 -- -- --
639 H381 H381 H381 E389 T375 T374 N372 -- -- --
640 V382 V382 V382 E390 A376 Q375 E373 -- -- --
641 N383 N383 N383 T391 D377 D376 K374 -- -- --
642 G384 G384 G384 G392 N378 N377 G375 -- -- A521
643 Q385 Q385 E385 E393 P379 P378 E376 -- -- K522
644 D386 D386 D386 D394 N380 D379 D377 -- -- K523
645 Q387 Q387 K387 K395 A381 Q380 V378 -- -- Q524
646 I388 V388 V388 V396 I382 V381 V379 R370 K384 V525
647 V389 V389 V389 I397 V383 F382 V380 I371 L385 I526
648 P390 P390 P390 P398 P384 P383 P381 K372 K386 P527
649 G391 G391 G391 G399 G385 G384 G382 G373 G387 G528
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
650 L392 L392 L392 L400 L386 L385 L383 L374 L388 L529
651 Y393 Y393 Y393 M401 M387 M386 F384 F375 F389 Y530
652 A394 A394 A394 A402 A388 A387 A385 A376 S390 G531
653 C395 C395 C395 C403 V389 V388 V386 V377 A391 A532
654 G396 G396 G396 G404 G390 G389 G387 G378 G392 G533
655 E397 E397 E397 E405 E391 E390 E388 E379 E393 E534
656 A398 A398 A398 A406 A392 A391 I389 C380 A394 V535
657 A399 A399 A399 A407 G393 G392 A390 S381 A395 T536
658 C400 C400 S400 C408 C394 C393 C391 S382 C396 G537
659 A401 A401 A401 V409 A395 A394 V392 V383 W397 G538
660 S402 S402 S402 S410 S396 S395 S393 G384 D398 -- cis-peptide in Mito, Wolinella.
661 V403 V403 V403 V411 V397 V396 V394 L385 M399 V539
662 H404 H404 H404 H412 H398 H397 H395 H386 H400 H540
663 G405 G405 G405 G413 G399 G398 G396 G387 G401 G541
664 A406 A406 A406 A414 A400 A399 A397 A388 F402 A542
665 N407 N407 N407 N415 N401 N400 N398 N389 N403 N543
666 R408 R408 R408 R416 R402 R401 R399 R390 R404 R544
Ackrell's R450C mutation in humans?
667 L409 L409 L409 L417 L403 L402 L400 L391 L405 L545
668 G410 G410 G410 G418 G404 G403 G401 G392 G406 G546
669 A411 A411 A411 A419 S405 S404 G402 S393 G407 G547
670 N412 N412 N412 N420 N406 N405 N403 N394 N408 N548
671 S413 S413 S413 S421 S407 S406 S404 S395 S409 A549
672 L414 L414 L414 L422 L408 L407 L405 L396 V410 I550
673 L415 L415 L415 L423 I409 I408 L406 A397 S411 S551
674 D416 D416 D416 D424 D410 D409 D407 E398 E412 D552
675 L417 L417 L417 L425 L411 L410 L408 L399 A413 I553
676 V418 V418 V418 V426 V412 V411 V409 V400 V414 I554
677 V419 V419 V419 V427 V413 V412 V410 V401 V415 T555
678 F420 F420 F420 F428 F414 F413 F411 F402 A416 F556
679 G421 G421 G421 G429 G415 G414 G412 G403 G417 G557
680 R422 R422 R422 R430 R416 R415 R413 R404 M418 R558
681 A423 A423 A423 A431 A417 A416 A414 L405 I419 L559
682 C424 C424 C424 V432 A418 A417 A415 A406 V420 A560
683 A425 A425 A425 A433 A419 A418 G416 G407 G421 G561
684 L426 L426 L426 H434 I420 I419 L417 E408 E422 E562
685 S427 S427 T427 T435 R421 R420 H418 Q409 Y423 E563
686 I428 I428 I428 V436 A422 A421 L419 A410 F424 A564
687 E429 A429 A429 A437 G423 G422 Q420 T411 A425 A565
688 E430 E430 E430 D438 E424 Q423 E421 E412 E426 K566
689 S431 S431 T431 T439 I425 V424 S422 R413 H427 Y567
690 C432 C432 C432 L440 V426 I425 I423 A414 C428 S568
691 R433 R433 K433 Q441 D427 D426 A424 A415 A429 K569
692 -- -- -- -- -- -- -- -- N430 K570
693 -- -- -- -- -- -- -- T416 T431 N571
694 P434 P434 P434 P442 P428 R427 E425 A417 Q432 --
695 G435 G435 G435 G443 K429 E428 Q426 G418 V433 --
696 D436 D436 E436 L444 A430 A429 G427 N419 D434 --
697 K437 K437 P437 P445 R431 Q430 A428 G420 L435 --
FAD domain
 698 V438 V438 V438 H446 P432 I431 L429 N421 E436 --
Helical domain
699 P439 P439 P439 K447 A433 P432 R430 E422 T437 --
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
700 P440 S440 S440 P448 A434 T433 D431 A423 K438 --
701 I441 I441 I441 L449 Y435 T434 A432 A424 T439 --
702 K442 K442 K442 P450 N436 N435 S433 I425 L440 --
703 P443 P443 P443 S451 Q437 K436 E434 E426 E441 --
704 N444 N444 N444 D452 A438 E437 S435 A427 K442 --
705 A445 A445 A445 L453 S439 Q438 D436 Q428 F443 --
706 G446 G446 G446 G454 V440 V439 V437 A429 V444 --
707 E447 E447 E447 K455 D441 D440 E438 A430 K445 --
708 E448 E448 E448 E456 K442 K441 A439 G431 G446 --
709 S449 S449 S449 S457 C443 A442 S440 V432 Q447 --
710 V450 V450 V450 I458 F444 L443 L441 E433 E448 --
711 M451 M451 A451 A459 A445 D444 D442 Q434 A449 --
712 N452 N452 N452 N460 R446 R445 R443 R435 Y450 --
713 L453 L453 L453 L461 F447 F446 L444 L436 M451 --
714 D454 D454 D454 D462 D448 D447 N445 K437 K452 --
715 K455 K455 K455 K463 G449 R448 R446 D438 S453 --
716 L456 L456 L456 L464 L450 I449 W447 L439 L454 --
717 R457 R457 R457 R465 R451 R450 N448 V440 V455 --
718 F458 F458 F458 N466 H452 N451 N449 N441 E456 --
719 A459 A459 A459 A467 A453 A452 N450 Q442 S457 --
720 D460 N460 D460 N468 K454 D453 R451 D443 K458 --
721 G461 G461 G461 G469 G455 G454 N452 G444 G459 --
722 S462 S462 T462 S470 H456 S455 G453 G445 T460 --
723 I463 I463 I463 R471 T457 V456 E454 E446 E461 --
724 R464 R464 R464 S472 P458 S457 D455 N447 D462 --
725 T465 T465 T465 T473 T459 T458 P456 W448 V463 --
726 S466 S466 S466 A474 A460 A459 V457 A449 F464 --
727 E467 E467 E467 E475 D461 D460 A458 K450 K465 --
728 L468 L468 A468 I476 L462 L461 I459 I451 I466 --
729 R469 R469 R469 R477 R463 R462 R460 R452 K467 --
730 L470 L470 L470 M478 L464 L463 K461 D453 N468 --
731 S471 N471 N471 N479 E465 E464 A462 E454 R469 --
732 M472 M472 M472 M480 M466 M465 L463 M455 M470 --
733 Q473 Q473 Q473 K481 Q467 Q466 Q464 G456 K471 --
734 K474 K474 K474 Q482 R468 R467 E465 L457 D472 --
735 S475 S475 T475 T483 T469 T468 C466 A458 V473 --
736 M476 M476 M476 M484 M470 M469 M467 M459 M474 --
737 Q477 Q477 Q477 Q485 Q471 Q470 Q468 E460 D475 --
738 N478 S478 S478 K486 A472 A471 H469 E461 D476 --
739 H479 H479 H479 D487 D473 D472 N470 G462 N477 --
740 A480 A480 A480 V488 A474 A473 F471 C463 V478 --
741 A481 A481 A481 S489 A475 A474 S472 G464 G479 -- A524V
742 V482 V482 V482 V490 V476 V475 V473 I465 I480 --
743 F483 F483 F483 F491 F477 F476 F474 Y466 F481 --
744 R484 R484 R484 R492 R478 R477 R475 R467 R482 --
745 V485 V485 T485 T493 T479 T478 E476 T468 D483 --
746 G486 G486 G486 Q494 D480 D479 G477 P469 G484 --
747 S487 S487 S487 S495 K481 K480 D478 E470 P485 --
748 V488 V488 I488 S496 T482 T481 A479 L471 H486 --
749 L489 L489 L489 L497 L483 L482 M480 M472 L487 --
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
750 Q490 Q490 Q490 D498 A484 A483 A481 Q473 E488 --
751 E491 E491 E491 E499 E485 E484 K482 K474 K489 --
752 G492 G492 G492 G500 G486 G485 G483 T475 S490 --
753 C493 C493 C493 V501 K487 V486 L484 I476 V491 --
754 G494 E494 E494 R502 A488 D487 E485 D477 K492 --
755 K495 K495 K495 N503 K489 K488 Q486 K478 E493 --
756 I496 I496 L496 I504 M490 M489 L487 L479 L494 --
757 S497 S497 S497 T505 T491 R490 K488 A480 E495 --
758 K498 S498 Q498 A506 E492 V491 V489 E481 E496 --
759 L499 L499 I499 V507 I493 I492 I490 L482 L497 --
760 Y500 Y500 Y500 E508 A494 A493 R491 Q483 Y498 --
761 G501 G501 R501 K509 A495 G494 E492 E484 K499 -- chick SNP R->C
762 D502 D502 D502 T510 K496 K495 R493 R485 K500 --
763 L503 L503 L503 F511 V497 L496 L494 F486 S501 --
764 K504 R504 A504 D512 A498 S497 K495 K487 K502 --
765 H505 H505 H505 D513 D499 D498 N496 R488 N503 --
766 L506 L506 L506 V514 L500 L499 A497 V489 V504 --
767 K507 K507 K507 K515 K501 K500 R498 R490 G505 --
768 T508 T508 T508 T516 V502 V501 L499 I491 I506 --
769 F509 F509 F509 T517 T503 T502 D500 T492 K507 --
770 D510 D510 D510 D518 D504 D503 D501 D493 N508 --
771 R511 R511 R511 R519 R505 R504 T502 T494 K509 -- R554W mutation
772 G512 G512 G512 S520 S506 S505 S503 S495 R510 --
773 M513 M513 I513 M521 L507 L506 S504 S496 L511 --
774 V514 V514 V514 I522 I508 I507 E505 V497 H512 --
775 W515 W515 W515 W523 W509 W508 F506 F498 A513 --
776 N516 N516 N516 N524 N510 N509 N507 N499 N514 --
777 T517 T517 T517 S525 S511 S510 T508 T500 P515 --
778 D518 D518 D518 D526 D512 D511 Q509 D501 E516 --
779 L519 L519 L519 L527 L513 L512 R510 L502 L517 --
780 V520 V520 V520 V528 M514 M513 V511 L503 E518 --
781 E521 E521 E521 E529 E515 E514 E512 Y504 E519 --
782 T522 T522 T522 T530 T516 T515 C513 T505 A520 --
783 L523 L523 L523 L531 L517 L516 L514 I506 Y521 --
784 E524 E524 E524 E532 E518 E517 E515 E507 R522 --
785 L525 L525 L525 L533 L519 L518 L516 L508 V523 --
786 Q526 Q526 Q526 Q534 T520 T519 D517 G509 P524 --
787 N527 N527 N527 N535 N521 N520 N518 H510 M525 --
788 L528 L528 L528 L536 L522 L521 L519 G511 M526 --
789 M529 M529 M529 L537 M523 M522 M520 L512 L527 --
790 L530 L530 L530 T538 P524 P523 E521 N513 K528 --
791 C531 C531 C531 C539 N525 N524 T522 V514 V529 --
792 A532 A532 A532 A540 A526 A525 A523 A515 A530 --
793 L533 L533 L533 S541 L527 L526 Y524 E516 L531 --
794 Q534 Q534 Q534 Q542 A528 A527 A525 C517 C532 --
795 T535 T535 T535 T543 T529 T528 T526 M518 V533 --
796 I536 I536 I536 A544 I530 I529 A527 A519 A534 --
797 Y537 Y537 Y537 V545 V531 V530 V528 H520 K535 --
798 G538 G538 G538 S546 G532 A531 S529 S521 G536 --
799 A539 A539 A539 A547 A533 A532 A530 A522 A537 --
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
800 E540 E540 E540 A548 E534 E533 N531 M523 L538 --
801 A541 A541 A541 N549 A535 A534 F532 A524 D539 --
802 R542 R542 R542 R550 R536 R535 R533 R525 R540 --
803 K543 K543 K543 K551 K537 K536 T534 K526 T541 --
804 E544 E544 E544 E552 E538 E537 E535 E527 E542 --
805 S545 S545 S545 S553 S539 S538 S536 S528 S543 --
806 R546 R546 R546 R554 R540 R539 R537 R529 R544 -- R589W mutation
807 G547 G547 G547 G555 G541 G540 G538 G530 G545 --
808 A548 G548 A548 A556 A542 A541 A539 A531 A546 --
809 H549 P549 H549 H557 H543 H542 H540 H532 H547 --
810 A550 R550 A550 A558 A544 A543 S541 Q533 N548 --
811 R551 R551 R551 R559 S545 H544 R542 R534 R549 --
812 E552 E552 E552 E560 E546 E545 F543 L535 E550 --
813 D553 D553 D553 D561 D547 D546 D544 D536 D551 --
814 Y554 F554 Y554 Y562 H548 Y547 F545 E537 Y552 --
815 K555 K555 K555 P563 A549 P548 P546 G538 P553 -- Helical Domain
816 V556 E556 L556 N564 T550 E549 D547 C539 K554 --
chick SNP L->F
817 R557 R557 R557 R565 R551 R550 R548 T540 R555 -- C
-term domain
818 I558 V558 I558 D566 D552 D551 D549 E541 D556 --
819 D559 D559 D559 D567 D553 D552 D550 R542 D557 --
820 E560 E560 E560 E568 V554 A553 E551 D543 I558 -- chick SNP E->D
821 Y561 Y561 F561 -- N555 N554 N552 D544 N559 --
822 D562 D562 D562 -- -- -- -- V545 W560 --
823 Y563 Y563 Y563 -- -- -- -- -- L561 --
824 S564 S564 S564 -- -- -- -- -- N562 --
825 K565 K565 K565 -- -- -- -- -- R563 --
826 P566 P566 P566 -- -- -- -- -- T564 --
827 I567 I567 L567 -- -- -- -- -- L565 --
828 Q568 Q568 Q568 -- -- -- -- -- A566 --
829 G569 G569 G569 -- -- -- -- -- S567 --
830 Q570 Q570 Q570 -- -- -- -- -- W568 --
831 Q571 Q571 Q571 -- -- -- -- -- P569 --
832 K572 K572 K572 -- -- -- -- -- N570 --
833 K573 K573 R573 -- -- -- -- -- P571 --
834 P574 P574 P574 -- -- -- -- -- E572 --
835 F575 F575 F575 -- -- -- -- -- Q573 --
836 E576 E576 E576 -- -- -- -- -- T574 --
837 E577 Q577 E577 -- -- -- -- -- L575 --
838 -- -- -- -- -- -- -- -- P576 --
839 -- -- -- -- -- -- -- -- T577 --
840 -- -- -- -- -- -- -- -- L578 --
841 -- -- -- -- -- -- -- -- E579 --
842 -- -- -- -- -- -- -- -- Y580 --
843 -- -- -- -- -- -- -- -- E581 --
844 -- -- -- -- -- -- -- -- A582 --
845 -- -- -- -- -- -- -- -- L583 --
846 -- -- -- -- -- -- -- -- D584 --
847 -- -- -- -- -- -- -- -- V585 --
848 H578 H578 H578 H569 -- -- -- N546 N586 --
849 W579 W579 W579 W570 W556 W555 W553 F547 E587 --
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
850 R580 R580 R580 M571 R557 R556 L554 L548 M588 --
851 K581 K581 K581 K572 K558 K557 C555 K549 E589 --
852 H582 H582 H582 H573 H559 H558 H556 H550 I590 --
853 T583 T583 T583 T574 S560 S559 S557 T551 A591 --
854 L584 L584 L584 L575 I561 L560 L558 L552 P592 --
855 S585 S585 S585 S576 M562 A561 Y559 A553 R593 --
856 Y586 Y586 Y586 W577 R563 W562 L560 F554 Y594 --
857 V587 V587 V587 Q578 V564 I563 P561 R555 R595 --
858 D588 D588 D588 K579 E565 E564 E562 D556 G596 --
859 V589 I589 V589 D580 D566 G565 S563 A557 Y597 --
860 G590 K590 K590 V581 N567 N566 -- D558 G598 --
861 T591 T591 S591 A582 -- -- -- G559 A599 --
862 G592 G592 G592 A583 -- -- -- -- K600 --
863 -- -- -- -- -- -- -- -- G601 --
864 -- -- -- -- -- -- -- -- N602 --
865 -- -- -- -- -- -- -- -- Y603 --
866 -- -- -- -- -- -- -- -- I604 --
867 -- -- -- -- -- -- -- -- E605 --
868 -- -- -- -- -- -- -- -- N606 --
869 K593 K593 K593 P584 K568 D567 -- T560 P607 --
870 V594 V594 V594 V585 V569 V568 E564 T561 L608 --
871 T595 T595 T595 T586 D570 K569 S565 R562 S609 --
872 L596 L596 L596 L587 L571 L570 M566 L563 V610 --
873 E597 E597 K597 K588 S572 A571 T567 E564 K611 --
874 Y598 Y598 Y598 Y589 Y573 Y572 R568 Y565 R612 --
875 R599 R599 R599 R590 R574 R573 R569 S566 Q613 --
876 P600 P600 P600 R591 P575 P574 S570 D567 E614 --
877 V601 V601 V601 V592 V576 V575 V571 V568 E615 --
878 I602 I602 I602 I593 I577 H576 N572 K569 I616 --
879 D603 D603 D603 D594 T578 L577 M573 I570 D617 --
880 K604 R604 R604 H595 E579 E578 E574 -- K618 --
881 T605 T605 T605 T596 P580 P579 P575 -- I619 --
882 L606 L606 L606 L597 L581 L580 K576 -- Q620 --
883 N607 N607 N607 D598 T582 T581 L577 -- S621 --
884 E608 E608 E608 E599 T583 R582 R578 -- E622 --
885 A609 T609 E609 K600 E584 Q583 -- -- L623 --
886 -- -- -- -- A585 D584 -- -- E624 --
887 -- -- -- -- E586 E585 -- -- A625 --
888 -- -- -- -- G587 G586 -- -- A626 --
889 -- -- -- -- G588 G587 -- -- G627 --
890 -- -- -- -- I589 I588 -- -- K628 --
891 D610 D610 D610 E601 S590 D589 -- -- D629 --
892 C611 C611 C611 C602 L591 L590 -- -- R630 --
893 A612 A612 S612 P603 A592 K591 P579 T571 H631 --
894 T613 T613 S613 S604 K593 K592 A580 T572 A632 --
895 V614 V614 V614 V605 I594 I593 F581 L573 I633 --
896 P615 P615 P615 P606 A595 A594 P582 P574 Q634 --
897 P616 P616 P616 P607 P596 P595 P583 P575 E635 --
898 A617 A617 A617 T608 K597 K596 K584 A576 A636 --
899 I618 I618 I618 V609 A598 A597 I585 K577 L637 --
Homo Gallus Rb.cps EcoSDH Wolin
Bos Sc.cer Pc.den EcoFRD Shewan
900 R619 R619 R619 R610 R599 R598 R586 R578 M638 --
901 S620 S620 S620 A611 T600 V599 T587 V579 P639 --
902 Y621 Y621 Y621 Y612 F601 Y600 Y588 Y580 Y640 --
903 -- -- -- -- -- -- -- G581 E641 --
904 -- -- -- -- -- -- -- G582 L642 --
905 -- -- -- -- -- -- -- E583 P643 --
906 -- -- -- -- -- -- -- A584 A644 --
907 -- -- -- -- -- -- -- D585 K645 --
908 -- -- -- -- -- -- -- A586 Y646 --
909 -- -- -- -- -- -- -- A587 K647 --
910 -- -- -- -- -- -- -- D588 A648 --
911 -- -- -- -- -- -- -- K589 R649 --
912 -- -- -- -- -- -- -- A590 N650 --
913 -- -- -- -- -- -- -- E591 E651 --
914 -- -- -- -- -- -- -- A592 R652 --
915 -- -- -- -- -- -- -- A593 L653 --
916 -- -- -- -- -- -- -- N594 G654 --
917 -- -- -- -- -- -- -- K595 D655 --
918 -- -- -- -- -- -- -- K596 K656 --
919 -- -- -- -- -- -- -- E597 -- --
920 -- -- -- -- -- -- -- K598 -- --
921 -- -- -- -- -- -- -- A599 -- --
922 -- -- -- -- -- -- -- N600 -- --
923 -- -- -- -- -- -- -- G601 -- --
924 622 622 622 613 602 601 589 602 657 --

>Homo
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------SAKVSDSISAQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEA--GFNTACVTKLFPTRSHTVAAQGGINAALGN-----
MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFG
--------------GQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRY-DTSYFVEY
FALDLLME-NGECRGVIALCIEDGSIHRIRAKNTVVATGGYGR------------TYFSCTSAHTSTGDGTA
MITRAGLP-CQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAP-----
------VAKDLASRDVVSRSMTLEIREGRGCG-PEKDHVYLQLHHLPPEQLATRLPGISE
TAMIFAGVDV----------------------------------
----------TKEPIPVLPTVHYNMGGIPTNYKGQVLR--HVNGQDQIVPGLYACGEAAC
ASVHGANRLGANSLLDLVVFGRACALSIEESCR--PGDKVPPIKPNAGEESVMNLDKLRF
ADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTD
LVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDYSKPIQGQQKKPFE
E----------HWRKHTLSYVDVGTG------KVTLEYRPVIDKTLNEA-----DCATVP
PAIRSY---------------------
>cattle
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------SAKVSDAISAQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEA--GFNTACVTKLFPTRSHTVAAQGGINAALGN-----
MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFG
--------------GQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRY-DTSYFVEY
FALDLLME-SGECRGVIALCIEDGSIHRIRARNTVIATGGYGR------------TYFSCTSAHTSTGDGTA
MVTRAGLP-CQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAP-----
------VAKDLASRDVVSRSMTLEIREGRGCG-PEKDHVYLQLHHLPPAQLAMRLPGISE
TAMIFAGVDV----------------------------------
----------TKEPIPVLPTVHYNMGGIPTNYKGQVLR--HVNGQDQVVPGLYACGEAAC
ASVHGANRLGANSLLDLVVFGRACALSIAESCR--PGDKVPSIKPNAGEESVMNLDKLRF
ANGSIRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKISSLYGDLRHLKTFDRGMVWNTD
LVETLELQNLMLCALQTIYGAEARKESRGGPRREDFKERVDEYDYSKPIQGQQKKPFE
Q----------HWRKHTLSYVDIKTG------KVTLEYRPVIDRTLNET-----DCATVP
PAIRSY---------------------
>Gallus
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------STKVSDSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEA--GFNTACVTKLFPTRSHTVAAQGGINAALGN-----
MEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEEGKIYQRAFG
--------------GQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRY-DTSYFVEY
FALDLLME-NGECRGVIALCIEDGTIHRFRAKNTVIATGGYGR------------TYFSCTSAHTSTGDGTA
MVTRAGLP-CQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAP-----
------VAKDLASRDVVSRSMTIEIREGRGCG-PEKDHVYLQLHHLPPQQLATRLPGISE
TAMIFAGVDV----------------------------------
----------TKEPIPVLPTVHYNMGGIPTNYKGQVIT--HVNGEDKVVPGLYACGEAAS
ASVHGANRLGANSLLDLVVFGRACALTIAETCK--PGEPVPSIKPNAGEESVANLDKLRF
ADGTIRTSEARLNMQKTMQSHAAVFRTGSILQEGCEKLSQIYRDLAHLKTFDRGIVWNTD
LVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLRIDEFDYSKPLQGQQKRPFE
E----------HWRKHTLSYVDVKSG------KVTLKYRPVIDRTLNEE-----DCSSVP
PAIRSY---------------------
>Sccere
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------QTQGSVNGSASRSADGKYHIID
HEYDCVVIGAGGAGLRAAFGLAEA--GYKTACISKLFPTRSHTVAAQGGINAALGN-----
MHKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAPKSIIELEHYGVPFSRTENGKIYQRAFG
--------------GQTKEYGKGAQAYRTCAVADRTGHALLHTLYGQALRH-DTHFFIEY
FALDLLTH-NGEVVGVIAYNQEDGTIHRFRAHKTIIATGGYGR------------AYFSCTSAHTCTGDGNA
MVSRAGFP-LQDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAP-----
------TAKDLACRDVVSRAITMEIREGRGVG-KKKDHMYLQLSHLPPEVLKERLPGISE
TAAIFAGVDV----------------------------------
----------TKEPIPIIPTVHYNMGGIPTKWNGEALTIDEETGEDKVIPGLMACGEAAC
VSVHGANRLGANSLLDLVVFGRAVAHTVADTLQ--PGLPHKPLPSDLGKESIANLDKLRN
ANGSRSTAEIRMNMKQTMQKDVSVFRTQSSLDEGVRNITAVEKTFDDVKTTDRSMIWNSD
LVETLELQNLLTCASQTAVSAANRKESRGAHAREDYPNRDDE----------------
-----------HWMKHTLSWQKDVAA------PVTLKYRRVIDHTLDEK-----ECPSVP
PTVRAY---------------------
>Rbcaps
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MASYTYET
HNYDVVVVGAGGAGLRATLGMAEQ--GLRTACVTKVFPTRSHTVAAQGGIAASLGN-----
MGPDSWQWHMFDTVKGSDWLGDTDAMEYLARSAPAAVYELEHYGVPFSRTEAGKIYQRPFG
--------------GHTTEFGDGPPVQRTCAAADRTGHAILHTLYGQSLKN-NAEFFIEY
FALDLIMSEDGVCQGVVCWKLDDGTFHVFNAKMTVLATGGYGR------------AYFSATSAHTCTGDGGG
MVARAGLA-LQDMEFVQFHPTGIYGSGCLITEGARGEGGYLTNSQGERFMERYAP-----
------HYKDLAPRDYVSRCMTLEIREGRGVG-EHKDHIHLNLSHLPKEALAERLPGISE
SAKIFAGVDV----------------------------------
----------TKEPIPVLPTVHYNMGGIPTNYWGEALN-PTADNPNAIVPGLMAVGEAGC
ASVHGANRLGSNSLIDLVVFGRAAAIRAGEIVD--PKARPAAYNQASVDKCFARFDGLRH
AKGHTPTADLRLEMQRTMQADAAVFRTDKTLAEGKAKMTEIAAKVADLKVTDRSLIWNSD
LMETLELTNLMPNALATIVGAEARKESRGAHASEDHATRDDVN---------------
------------WRKHSIMRVEDN--------KVDLSYRPVITEPLTTEAEGGISLAKIA
PKARTF---------------------
>Pcdeni
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MAAYKYET
HEYDVVVVGAGGAGLRATLGMAEQ--GLRTACVTKVFPTRSHTVAAQGGIAASLSN-----
MGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQRPFG
--------------GHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKE-KAEFFIEY
FALDLIIT-DGACTGVVCWKLDDGTIHVFNAKMVVLATGGYGR------------AYFSATSAHTCTGDGGG
MVARAGLP-LQDMEFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAP-----
------TYKDLASRDVVSRCITIEIREGRGVG-PHKDHMHLNLMHLPPESLAERLPGISE
SAKIFAGVDV----------------------------------
----------TREPIPILPTVHYNMGGIPTNYWGEVLN-PTQDNPDQVFPGLMAVGEAGC
ASVHGANRLGSNSLIDLVVFGRAAAIRAGQVID--REAQIPTTNKEQVDKALDRFDRIRN
ADGSVSTADLRLEMQRTMQADAAVFRTDKTLAEGVDKMRVIAGKLSDLKVTDRSLIWNSD
LMETLELTNLMPNALATIVAAEARKESRGAHAHEDYPERDDAN---------------
------------WRKHSLAWIEGN--------DVKLAYRPVHLEPLTRQDEGGIDLKKIA
PKARVY---------------------
>EcoliSDH
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------------------MKLPV
REFDAVVIGAGGAGMRAALQISQS--GQTCALLSKVFPTRSHTVSAQGGITVALGN-----
THEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
--------------GQSKNFG-GEQAARTAAAADRTGHALLHTLYQQNLKN-HTTIFSEW
YALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGR------------IYQSTTNAHINTGDGVG
MAIRAGVP-VQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAP-----
------NAKDLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILE
LSRTFAHVDP----------------------------------
----------VKEPIPVIPTCHYMMGGIPTKVTGQALT-VNEKGEDVVVPGLFAVGEIAC
VSVHGANRLGGNSLLDLVVFGRAAGLHLQESIA--EQGALRDASESDVEASLDRLNRWNN
NRNGEDPVAIRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQ
RVECLELDNLMETAYATAVSANFRTESRGAHSRFDFPDRDDEN---------------
------------WLCHSLYLPES----------ESMTRRSVNMEPKLR--------PAFP
PKIRTY---------------------
>EcoliFRD
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------QT
FQADLAIVGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSHTVAAEGGSAAVA-------
QDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLELWGCPWSRRPDG--------
----------SVNVRR---FG-GMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEH
FVLDILVD-DGHVRGLVAMNMMEGTLVQIRANAVVMATGGAGR------------VYRYNTNGGIVTGDGMG
MALSHGVP-LRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETP
LGEPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLHERLPFICE
LAKAYVGVDP----------------------------------
----------VKEPIPVRPTAHYTMGGIETDQNCET-----------RIKGLFAVGECSS
VGLHGANRLGSNSLAELVVFGRLAGEQATERAA-TAGNGNEAAIEAQAAGVEQRLKDLVN
QDGGENWAKIRDEMGLAMEEGCGIYRTPELMQKTIDKLAELQERFKRVRITDTSSVFNTD
LLYTIELGHGLNVAECMAHSAMARKESRGAHQRLDEGCTERDDV--------------
-----------NFLKHTLAFRDADG-------TTRLEYSDVKI-------------TTLP
PAKRVYGGEADAADKAEAANKKEKANG
>Wolinel
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------------MKV
QYCDSLVIGGGLAGLRAAVATQQK--GLSTIVLSLIPVKRSHSAAAQGGMQASLGNSKMS-
-DGDNEDLHFMDTVKGSDWGCDQKVARMFVNTAPKAIRELAAWGVPWTRIHKGDRMAIINA
QKTTITEEDFRHGLIHSRDFG-GTKKWRTCYTADATGHTMLFAVANECLKL-GVSIQDRK
EAIALIHQ-DGKCYGAVVRDLVTGDIIAYVAKGTLIATGGYGR------------IYKNTTNAVVCEGTGTA
IALETGIAQLGNMEAVQFHPTPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPE----
-------KKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHIETNLRDVQE
ICEYFAGIDP----------------------------------
----------AEKWAPVLPMQHYSMGGIRTDYRGEA-----------KLKGLFSAGEAAC
WDMHGFNRLGGNSVSEAVVAGMIVGEYFAEHCANTQVDLETKTLEKFVKGQEAYMKSLVE
SKGTEDVFKIKNRMKDVMDDNVGIFRDGPHLEKSVKELEELYKKSKNVGIKNKRLHANPE
LEEAYRVPMMLKVALCVAKGALDRTESRGAHNREDYPKRDDINWLNRTLASWPNPEQT
LPTLEYEALDVNEMEIAPRYRGYGAKGNYIENPLSVKRQEEIDKIQSELEAAGKDRHAIQ
EALMPYELPAKYKARNERLGDK-----
>shewanella
--------------------------------------------------------ADNL
AEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPG
EVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPH
DTVDVVVVGSGGAGFSAAISATDS--GAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAK
KITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVG-------MMG
--------------------GASVNRAHRPTGGAGVGAHVVQVLYDNAVKR-NIDLRMNT
RGIEVLKDDKGTVKGILVKGMYKG-YYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLD
VAENAGGA-LKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEIT------
------------TRDKASAAILA----------QTGKSAYLIFDDSVRKSLSKIDKYIGL
GVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFER
PNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMN-----AKKQVIPGLYGAGEVTG
G-VHGANRLGGNAISDIITFGRLAGEEAAKYSKKN
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------------


-------------------------------------------------------